PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family bHLH
Protein Properties Length: 94aa    MW: 10382.9 Da    PI: 10.6568
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490021.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.41.3e-0821601554
                    HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
             HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                    +i +  ++L +l+P++   +s+K+s a +L+++++YIk+L
  XP_004490021.1 21 QITDLVAKLLRLIPELRPSRSGKVSAAKVLQETCNYIKNL 60
                    6889999********779********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.216660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.7E-62160IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474595.37E-92182IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.4E-72178IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSRSRQ SGASSEITDA QITDLVAKLL RLIPELRPSR SGKVSAAKVL QETCNYIKNL  60
HREVDDLSDR LSQLLATTDS NSAQAAIIRS LLMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1377481e-95BT137748.1 Medicago truncatula clone JCVI-FLMt-8L3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490021.18e-61PREDICTED: transcription factor PRE6
SwissprotF4JCN91e-37PRE4_ARATH; Transcription factor PRE4
TrEMBLA0A151RGX89e-50A0A151RGX8_CAJCA; Transcription factor bHLH135 family
STRINGGLYMA02G02250.17e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56734143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.14e-38bHLH family protein